Complementary-Determining Region Invertebrate Primitive Antibody From;Sea Star »Modelization 3d With Human Igk

Review Article | DOI: https://doi.org/10.31579/2693-4779/213

Complementary-Determining Region Invertebrate Primitive Antibody From;Sea Star »Modelization 3d With Human Igk

  • Michel Leclerc *

Division of Biology/Biochemistry, University of Orléans, France.

*Corresponding Author: Michel Leclerc, Division of Biology/Biochemistry, University of Orléans, France.

Citation: Michel Leclerc, (2024), Complementary-Determining Region Invertebrate Primitive Antibody From;Sea Star »Modelization 3d With Human Igk, Clinical Research and Clinical Trials, 10(4); DOI:10.31579/2693-4779/213

Copyright: © 2024, Michel Leclerc. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.

Received: 18 June 2024 | Accepted: 05 July 2024 | Published: 16 August 2024

Keywords: artificial intelligence; urology; medical training; learning; technological advances

Abstract

Our findings consist of the importance of an individualized approach based on infectious risk and prudent antibiotic management to prevent antibiotic resistance, and highlight the need for further research to better assess the clinical impact of antibiotic prophylaxis in this specific context of transurethral resection of bladder tumor.

Introduction

10 years ago, we tried to clone, for the first time, the Asterias rubens  sea star IGKappa gene  by the use and the help of E.coli as amplificator [1]. It allowed, in à second time, to verify that the Young Protein, or anti-HRP Protein recognizes the HRP antigen [1,2]

In the present work we research Complementary Determining Regions called more briefly CDR1, CDR2, CDR3. Or Complementary-Determining Regions[3,4]

First, anti-HRP sequence in nucleotids is given :

5’GGA TCC GGA GGA ATG CGTGGCAACATGGCGTCTCTATGGATGTTCTTCTT

TGTCGTGGGGATAACTTTACAACGGAGTTTGGCGATTTACACGTTTCGCG

AGCAACCGTCGGACACTAGCGCGTTGCAGGGGAGCACAGTGGTGCTTCAC

TGCTCCGTTGAGCAGTACATAAACACCACGGCCATCGTTTGGTGGAGCCG

TGACTCGGTCATCAGCCACAACAAAGACCTGAAACTGTCCAGTCTAAACA

CCGACCAGCTCCAAAGGTACTCGATTTCAGGCGACGCATCTCGGGGGGAA

TTCAACCTTAAAATAGTGAACTTTACCGCCACAGACGCCGCCAGTTACCG

CTGTCAGATG TAA GAA TTC3’

with the tranlation https://web.expasy.org/translate/

gga tcc gga gga atg cgt ggc aac atg gcg tct cta tgg atg ttc ttc ttt gtc gtg ggg 

 G  S   G   G  M   R   G  N   M   A  S   L   W   M  F   F   F   V   V  G 

ata act tta caa cgg agt ttg gcg att tac acg ttt cgc gag caa ccg tcg gac act agc 

 I  T   L   Q  R   S   L  A   I   Y  T   F   R  E   Q   P  S   D   T  S 

gcg ttg cag ggg agc aca gtg gtg ctt cac tgc tcc gtt gag cag tac ata aac acc acg 

 A  L   Q   G  S   T   V  V   L   H  C   S   V  E   Q   Y  I   N   T  T 

gcc atc gtt tgg tgg agc cgt gac tcg gtc atc agc cac aac aaa gac ctg aaa ctg tcc 

 A  I   V   W  W   S   R  D   S   V  I   S   H  N   K   D  L   K   L  S 

agt cta aac acc gac cag ctc caa agg tac tcg att tca ggc gac gca tct cgg ggg gaa 

 S  L   N   T  D   Q   L  Q   R   Y  S   I   S  G   D   A  S   R   G  E 

ttc aac ctt aaa ata gtg aac ttt acc gcc aca gac gcc gcc agt tac cgc tgt cag atg 

 F  N   L   K  I   V   N  F   T   A  T   D   A  A   S   Y  R   C   Q  M 

taa gaa ttc 

 -  E   F  .

OR in ANOTHER WAY :

MRGNMASLWMFFFVVGITLQRSLAIYTFREQPSDTSALQGSTVVLHCSVEQYINTTAIVWWSRDSVISHNKDLKLSSLNTDQLQRYSISGDASRGEFNLKIVNFTATDAASYRCQMFA

Results

2 tables  issued from IMGT resume the following analysis  below : I):

https://www.imgt.org/3Dstructure-DB/cgi/DomainGapAlign.cgi  with default settings, 17/01/2024

IMGT/DomainGapAlign version : 4.10.3 (2021-12-06)

II) Table II:Alignments :

>starfish|IGKV1-5*01|33.3|||Pongo abelii

…EQPSDTSALQGSTVVLHCSVEQYI.....NTTAIVWWSRDSVISHNKDL.KL.......SSLNTDQL.QRYSISGDASRGEFNLKIVNFTATDAASYRCQ.......................

The conserved amino acids (positions 23, 41, 89, 104) are found in the starfish sequence.

This molecule appears to have an IG AA sequence as seen from the above analysis.

1. If it aligns with the Pongo IGKV1-5, the percentage of alignment is 33%, so it is a sequence that seems to have similarities to an IGKV gene when it comes to conserved amino acids.

It appears clearly that CDR1 and CDR2 exist in the sea star primitive antibody and less clearly for CDR3 [1] amino acid which is conserved)

Undoubtly :

These new parameters corroborate  the existence of an Invertebrate Primitive Antbody and NOT IG-LIKE as it is often said. We recall also the discovery by us of T and B sea star lymphocytes [5] Humoral specific response [6] Genomic data [7] with specially Invertebrate MHC genes

ALL these elements assess the existence of an IPA : Invertebrate Primitive Antibody which shares strong sequence alignments(at least for CDR1 and CDR2) with the Primate : Pongo pygmaeuserences . More recently, in a work concerning Modelizations in 3D of the sea star anti-HRP protein, we found a CDR3 region (see below this modelization when compared to AlphaFold prediction of IGKV1-5 03 from Homo sapiens (Figure.1)

                                                                          Figure 1 : Alfold prediction of IGKV1-5*03 Homo sapiens


In black sea star CDR1, CDR2, CDR3(at the left) determining regions

References

Dear Editorial Team, Clinical Medical Reviews and Reports. My experience with the journal was highly positive. The peer-review process was rigorous, constructive, and completed in a timely manner. The reviewers provided valuable comments that helped improve the quality and clarity of our manuscript. The editorial office was professional, responsive, and supportive throughout all stages of the publication process. Communication was clear and efficient, and any questions were addressed promptly. Overall, I found the journal to maintain high scientific standards and an excellent publication workflow. I would be pleased to consider submitting future work to this journal. Best wishes from, Elena Popa.

img

Dr Elena Popa

It was my pleasure to submit my testimonial concerning the Reviewer Board of our Scientific Journal “Brain and Neurological Disorders”. The Reviewers focused on some modifications and their contribution was helpful. The ladies of our Editorial Office were also supported my efforts. It was my honor to have such a co-operation and I am looking forward for more collaboration.

img

Dr Nikolaos Andreas Chrysanthakopoulos

Dear Grace Pierce, Editorial Coordinator of Journal of Clinical Research and Reports, Thank you for the speedy and efficient peer review process. I appreciate the fact that your peer reviewers do not take months to respond like with some other journals. I would also like to thank the editorial office for responding quickly to my questions. It is an excellent journal. I plan to submit more manuscripts in the future. Best wishes from, Robert W. McGee

img

Robert W McGee

Dear Grace Pierce, Editorial Coordinator of Journal of Clinical Research and Reports, Working with you and your team on our recent publication in JCRR has been a truly wonderful and enjoyable experience. The responses were prompt, and the reviewers were patient, constructive, and highly professional. One reviewer in particular gave me the feeling that a professor was carefully reading and commenting on my coursework, which was deeply touching. The entire process was straightforward and hassle‑free, with no tedious online forms to complete. I highly recommend this journal. Best wishes from, DR Aibing Rao, Head of R&D

img

Aibing Rao

I Appreciate the Opportunity to Share my Experience with the Journal of Clinical Research and Reports. The peer review process was timely and constructive, and the feedback provided helped improve the quality of our manuscript. The editorial office was professional, responsive, and supportive throughout the process, ensuring smooth communication and efficient handling of the submission. Overall, it was a positive experience collaborating with your team.

img

Kashani Mehdi

Dear Mercy Grace, Editorial Coordinator of Obstetrics Gynecology and Reproductive Sciences, We would like to express our gratitude for your help at all stages of publishing and editing the article. The editors of the magazine answer all the necessary questions and help at every stage. We will definitely continue to cooperate and publish other works in the Obstetrics Gynecology and Reproductive Sciences! Best wishes from, Alla Konstantinovna Politova,

img

Alla Konstantinovna Politova