Comparative Investigation of some Bioeffective short Peptides of Marine Derivation

Research Article | DOI: https://doi.org/10.31579/2766-2314/130

Comparative Investigation of some Bioeffective short Peptides of Marine Derivation

  • Nawal Abd El-Baky 1*
  • Amro A. Amara 1

Protein Research Department, Genetic Engineering and Biotechnology Research Institute (GEBRI), City of Scientific Research and Technological Applications (SRTA-City), Alexandria, Egypt.

*Corresponding Author: Nawal Abd El-Baky, Protein Research Department, Genetic Engineering and Biotechnology Research Institute (GEBRI), City of Scientific Research and Technological Applications (SRTA-City), Alexandria, Egypt.

Citation: Nawal Abd El-Baky, Amro A. Amara, (2024), Comparative Investigation of some Bioeffective Short Peptides of Marine Derivation, J, Biotechnology and Bioprocessing, 5(1); DOI:10.31579/2766-2314/130

Copyright: © 2024, Nawal Abd El-Baky. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.

Received: 05 December 2023 | Accepted: 20 December 2023 | Published: 16 January 2024

Keywords: cyclic peptides; hybrids or consensus; intrinsic disorder; marine bioeffective peptides; physicochemical properties

Abstract

Short peptides especially marine ones are unique in their amino acids constituents that build their structure/function/specificity. Their physical and chemical properties make them diverse in their bioeffectiveness. In this study, different bioeffective peptides from marine bio-resources were investigated to map distinctive properties in their structure that could affect their function and specificity. The investigated short peptides were Pardaxins (1-5), Arenicin (1-2), Clavanin-(A-E), Aurelin, Dicynthaurin, Halocidin subunit (A-B), Tachyplesin (II-III), and Polyphemusin (I-II). Their different sequences were analyzed comparatively through alignment, their clustering (phylogeny tree), amino acids-%, and some other physical and chemical parameters. For each of them, cyclic structure based on disulfide bonds if present, and intrinsic disorder, were inspected. First alignment revealed significant diversion among their sequences, while removing unshaded amino acids from the alignment made them closer in their phylogenetic relationships and more evident to design hybrids or consensus of sequences and functions. Polyphemusin I and II had the highest charges (net) with values of +7, yet Pardaxins 1, 3, and 5 had 0 charges. All of them had higher numbers of hydrophilic amino acids than hydrophobic ones except for Aurelin, Tachyplesin II and III, and Polyphemusin I and II. Seven from twenty studied peptides had cyclic structures via disulfide bond between their cysteine residues. One amino acid was not found in all sequences; methionine. All sequences displayed other missed amino acids than methionine. Dicynthaurin is a naturally ordered peptide (via PONDR score), but Halocidin subunit B was totally disordered. This study paves the way for designing hybrids or consensus of these peptides in sequences and functions depending on their distinctive features.

Introduction

Marine organisms are a vast cradle of unusual bioeffective peptides. Peptides from several aquatic species with extraordinary impending nutraceutical and medicinal values are the emphasis of up-to-date research. Their crucial biological roles including microbicidal or antioxidative action, antitumor efficiency, cardioprotective properties, immunomodulatory role, etc. lead to continuous efforts and attempts to design and formulate these peptides (Ngo et al., 2012, Cheung et al., 2015, Ovchinnikova, 2019). Marine bioeffective peptides are distinguished from non-marine-derived ones by their resistance to proteolysis performed by proteases of gastrointestinal tract due to steric factors caused by their cyclic nature (Pangestuti and Kim, 2017, Saint Jean et al., 2017, Ibrahim et al., 2018, Phyo et al., 2018).

Marine bioeffective peptides are diverse and have different characteristics. Pardaxin possess antimicrobial actions and comprises 33 amino acids (Kolusheva et al., 2008).  It is also utilized for repelling sharks (Shai, 1994). Pardaxins 1, 2 and 3 were produced from Pardachirus pavoninus, and Pardaxins 4 and 5 were released by Pardachirus marmoratus (Shai et al., 1988). Pardaxin resembles melittin in its ability to lyse cells of bacteria and mammals (Oren and Shai, 1996). It might prompt apoptosis, leading to antitumor efficacy (Hsu et al., 2011). Arenicin is bactericidal to Gram-negative bacteria and induced apoptosis (Cho and Lee, 2011, Krenev et al., 2020). It also showed antifungal effects (Park et al., 2011). Arenicin 1 and 2 were isolated from Arenicola marina (Ovchinnikova et al., 2004, Umnyakova et al., 2018). 

Aurelin was isolated from Aurelia aurita (jellyfish) and exhibited antimicrobial functions (Ovchinnikova et al., 2006, Shenkarev et al., 2012). Aurelin shared similar features in its structure with defensins and toxins that block channels (Ovchinnikova et al., 2006). It displayed bactericidal effectiveness on gram-negative and -positive bacteria (Ovchinnikova et al., 2006). 

Clavanins (Clavanin-A, -B, -C, -D and –E) were obtained from Styela clava (Tunicate) hemocytes and revealed antimicrobial efficiency (Juliano et al., 2017, Lehrer et al., 2001, Menzel et al., 2002). Their antimicrobial functions, which rely on their α-helical structures, were thoroughly investigated against various microbes and even viruses such as herpes simplex virus 1 (HSV-1) (Lee et al., 1997, Lehrer et al., 2001, Carriel-Gomes et al., 2007). Clavanin-A antimicrobial efficiency contributes to innate immune responses of Styela clava (Juliano et al., 2017). Besides, it caused in vitro viral inactivation of non-enveloped adenovirus and rotavirus (Carriel-Gomes et al., 2007). Clavanin-B was proved to have antiviral effectiveness on HIV (Ireland et al., 2008). 

Dicynthaurin, another marine bioeffective peptide possessing antimicrobial activity, has been isolated from Halocynthia aurantium (Lee et al., 2001a). It demonstrated expansive action on Gram +ve and Gram -ve bacteria nonetheless was not active against Candida albicans (Lee et al., 2001a). Halocidin was also obtained from Halocynthia aurantium and has bactericidal and anti-Candida actions (Jang et al., 2003, Jang et al., 2006, Jang et al., 2002). A peptide derived from Halocidin could effectively treat oral infection with Candida albicans in mice (Shin et al., 2013). 

Polyphemusins from Limulus polyphemus have antimicrobial efficacy (Marggraf et al., 2018, Lee et al., 2022).  They are potent against various microbes and viruses (Lee et al., 2022, Panteleev et al., 2020, Tziveleka et al., 2003). Tachyplesins antimicrobial peptides were released from hemocytes of horseshoe crab (Ohta et al., 1992).Tachyplesin I could penetrate cells and has anticancer properties (Vernen et al., 2019a).

In the present investigation, twenty bioeffective peptides (Pardaxins (1-5), Arenicin (1-2), Clavanin-(A-E), Aurelin, Dicynthaurin, Halocidin subunit (A-B), Tachyplesin (II-III), and Polyphemusin (I-II)) from marine bio-resources were explored to record distinctive properties in their structures affecting their antimicrobial functions. Their different sequences were compared to each other, in addition to amino acids-%, and some other chemical and physical parameters. For each of them, intrinsic disorder and cyclic structures based on disulfide bonds were also inspected. The obtained data can lead to designing of hybrids or consensus of these peptides that may achieve more potent actions or even new functions. 

Material and Methods

Investigated marine bioeffective peptides

The twenty marine bioeffective peptides included in the present work are found in Table 1. 

Pardaxins (1-5), 1, Arenicin 2, Clavanin-A, Clavanin-B, Clavanin-E, Clavanin-C, Clavanin-D, Aurelin, Dicynthaurin, Halocidin subunit A, Halocidin subunit B, Tachyplesin-II, Polyphemusin I, Tachyplesin III, Polyphemusin II have lengths of 33, 21, 21, 23, 23, 22, 23, 22, 40, 30, 18, 15, 17, 18, 16, and 18 amino acids, respectively.

Peptide parent nameSpecific nameSequence
PardaxinsPardaxins lGFFALIPKIISSPLFKTLLSAVGSALSSSGEQE
Pardaxins 2GFFALIPKIISSPIFKTLLSAVGSALSSSGGQE
Pardaxins 3GFFAFIPKIISSPLFKTLLSAVGSALSSSGEQE
Pardaxins 4GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE
Pardaxins 5GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE
ArenicinArenicin 1RWCVYAYVRVRGVLVRYRRCW
Arenicin 2RWCVYAYVRIRGVLVRYRRCW
ClavaninsClavanin-AVFQFLGKIIHHVGNFVHGFSHVF
Clavanin-BVFQFLGRIIHHVGNFVHGFSHVF
Clavanin-CVFHLLGKIIHHVGNFVYGFSHVF
Clavanin-DFKLLGRIIHHVGNFVYGFSHVF
Clavanin-EFKLLGKIIHHVGNFVHGFSHVF
AurelinAurelinAACSDRAHGHICESFKSFCKDSGRNGVKLRANCKKTCGLC
DicynthaurinDicynthaurinILQKAVLDCLKAAGSSLSKAAITAIYNKIT
HalocidinHalocidin subunit AWLNALLHHGLNCAKGVLA
Halocidin subunit BALLHHGLNCAKGVLA
TachyplesinTachyplesin IIRWCFRVCYRGICYRKCR
Tachyplesin IIIWCFRVCYRGICYRKCR
PolyphemusinPolyphemusin IRRWCFRVCYRGFCYRKCR
Polyphemusin IIRRWCFRVCYKGFCYRKCR

Table 1: The studied peptides sequences.

Peptide sequences comparison with Ugene

Alignment No. 1

The up-to-date free version of Ugene 49.1 (Portable) was used to do the peptides sequences comparison (alignment) (Okonechnikov et al., 2012, Rose et al., 2018). This alignment was carried out by the alignment selection with Clustal Omega in the software since the investigated peptides had different lengths. The shading was done for amino acids with analogous physicochemical features. 

Alignment No. 2

Aiming to increase the probability of finding close associations between the twenty peptides sequences to facilitate planning of peptides hybrids, the unshaded amino acids after using the physicochemical shading selection were eliminated. The obtained sequences were aligned once more and even adjusted manually afterwards. This created reduced hypothetical peptides sequences. 

After running each of the fore-mentioned alignments, the phylogeny tree was generated. The involved mode in tree building was Neighbor Joining and distance matrix was Jones-Taylor-Thornton. 

Recording the properties of the twenty peptides’ complete sequences

The peptides general features, which included mass (Da), isoelectric point, net charge, hydrophobicity, and extinction coefficients were attained from the PepDraw web site (https://pepdraw.com).

Drawing cyclic peptides structures based on disulfide bonds 

If studied peptides had cyclic structures via disulfide bond between cysteine residues was detected via PepSMI (https://www.novoprolabs.com/tools/convert-peptide-to-smiles-string).

Concluding the amino acids-% in the investigated peptides

DAMBE 7.2.102 was utilized to estimate the amino acids-% in each of the twenty peptides sequences (complete ones not reduced hypothetical peptides sequences) under investigation (Xia, 2018). 

Data plotting of amino acids-%

The data of amino acids-% were considered in PAST 4.14. software using the clustering analysis option (Hammer et al., 2001). Neighbor joining was chosen with Hoen similarity index to cluster comparable peptide groups. 

The software plotted these data to elucidate the variations within amino acids or within the peptides. It also enabled contrasts between the diverse amino acids as well as viewing the standard deviations of their existence % among peptides, which mirrored the distinction within different peptides constituent from each amino acid. 

Helical Wheel (HW)

Anthreprot 6.9.3. determined the HW of each peptide sequence to record the hydrophobic amino acids and hydrophilic ones on the surface of HW and their distribution through the complete peptides sequences and reduced hypothetical ones (Deléage et al., 1989, Deléage et al., 1988, Deléage et al., 2001, Deléage, 2012). 

Specifying the amino acids that had disorder

All sequences were loaded in the PrDOS server to find any amino acid that has disorder or form with other ones, a disorder region. PrDOS accepted all the sequences lengths involved in this study (Ishida and Kinoshita, 2007). In addition, PONDR (www.pondr.com) was used to find natural disorder compared to crystallization data of natural proteins but in peptides that have sequence length of ≥ 30 amino acids. flDPnn was used to map propensity of disorder for investigated peptides (Hu et al., 2021). 

Results and Discussion

Peptides and specifically peptides from marine derivation showed unlimited potentials (Rawat et al., 2006, Liu et al., 2015, Simonetti et al., 2009, De Clercq, 2000). They found their way in different applications including fungicidal (Jang et al., 2006, Fan et al., 2023, Han et al., 2016), bactericial (Ohta et al., 1992, Panteleev et al., 2017, Saito et al., 1995, Serna et al., 2021, Li et al., 2020), virucidal (even to SARS-CoV-2) (Gogineni et al., 2015, Xie et al., 2016, Riccio et al., 2020, Raihan et al., 2021), anticancer (Vernen et al., 2019a, Ahmed et al., 2021, Vernen et al., 2019b, Zhang et al., 2021, Han et al., 2015, Lin et al., 2013), etc.

This study involved random selection of twenty bioeffective peptides from marine derivation; Arenicin (Arenicin 1 and 2) (Cho and Lee, 2011, Krenev et al., 2020, Park et al., 2011, Ovchinnikova et al., 2004, Umnyakova et al., 2018), Aurelin (Ovchinnikova et al., 2006, Shenkarev et al., 2012), Clavanins (-A, -B, -C, -D and -E) (Silva et al., 2015), Dicynthaurin (Bringezu et al., 2007b, Lee et al., 2001b, Bringezu et al., 2007a, Majerowicz et al., 2007, Wen et al., 2007), Halocidin subunit A and subunit B (Shin et al., 2010, Han et al., 2016), Pardaxins 1-5 (Oren and Shai, 1996), Polyphemusin I and II (Marggraf et al., 2018, Lee et al., 2022), and Tachyplesin II and III (Ohta et al., 1992, Vernen et al., 2019a). Their sequences were compared to each other, in addition to amino acids-%, and other chemical and physical parameters. Their disorder properties and cyclic structures based on disulfide bonds were also checked.

Alignment No. 1

Firstly, we performed the classical step to compare their sequences; alignment. Apparently, the peptides sequences were confusing to the alignment softwares because of their different lengths, and none of them gave the same result (data not shown). Meanwhile, Clustal-Omega gave more appropriate results (Figure 1), where similarity could be observed, even if the amino acids was still scattered. This gave us the idea to use the physicochemical properties mode to shade the similar amino acids and to eliminate the unshaded ones in the following run. 

Figure 1 revealed that peptides from the same source were aligned together. For example, Pardaxins 1 to 5 have been all aligned as a separate cluster. Besides, Tachyphemusin II and III were aligned with Polyphemusin I and II along with Arenicin 1 and 2. In the middle, Clavanin A-E, Aurelin, Halocidin subunit A and B showed similarity. In fact, Clustal Omega exhibited perfect grouping for analogous regions. 

Furthermore, the shadding was based on the physiochemical properties of the amino acids (Figure 1). 

Figure 1: Multiple alignment of the complete sequences of the investigated peptides with Clustal Omega (Ugene software).

Amino acids that appeared without coloring (either did not have unique physiochemical characteristics at their position or did not align with a region of distinctive physciochemical features) were removed and the reduced hypothetical sequences were realigned.

Alignment No. 2

After removing the unshaded amino acids and performing a second alignment run, the similarity became more obvious (Figure 2 and Figure 3). If Arenicin 1 and 2 was moved down manually, all of the hypothetical sequences would align together in different regions as in Figure 3. Such approach might be useful in designing peptides de novo or hybrids.

Figure 2: Multiple alignment of the reduced hypothetical sequences of the investigated peptides.

Figure 3: Multiple alignment of the reduced hypothetical sequences of the investigated peptides after adjustment manually.The phylogeny tree obtained from Ugene of the aligned twenty peptides sequences confirmed that removing unshaded amino acids increased the clustering of peptides of different classes together (Figure 4, and Figure 5). The cadre showed grouping of the peptides (Arenicin 2, Halocidin subunit A and B, Clavanin-B, Tachyplesin III, Clavanin-E, Polyphemusin I, Clavanin-A, Tachyplesin II, Clavanin-C, Polyphemusin II, and Clavanin- D) due to similarity after reducing the original sequence (Figure 5).

Figure 4: Phylogeny tree from the alignment of complete peptides sequences.

Figure 5: Phylogeny tree from the alignment of reduced hypothetical peptides sequences. The cadre showed grouping of the peptides due to similarity after reducing the original sequence.

Recording the properties of the twenty peptides’ complete sequences

Table 2 illustrated the properties of the twenty peptides amino acids sequences. Aurelin had the highest mass of 4300 Da and uppermost hydrophobicity of +45.67 Kcal * mol-1 among all peptides (Table 2). Polyphemusin I and II had the utmost charges (net) with values of +7, yet Pardaxins 1, 3, and 5 had 0 charges (Table 2). Arenicin 1 and 2 exhibited the leading isoelectric point of 11.14 (Table 2).

Peptide Name            Length

Mass

(Da)

isoelectric

point (pI)

Net chargeHydrophobicity Kcal * mol-1

Extinction coefficient

M-1* cm-I

Extinction coefficient2

M-1* cm-I

Arenicin 1212758.4611.14+6+10.511547015595
Arenicin 2212772.4811.14+6 +9.8515595 15470 
Aurelin404300.008.94+5+45.67375 
Clavanin-A232665.409.93+1+11.67 
Clavanin-B232693.4010.90+1+10.6
Clavanin-C232666.429.59+1+10.65 1490 1490 
Clavanin-D222586.4010.38+2+10.591490 1490 
Clavanin-E222532.3910.59+2+14.62 0
Dicynthaurin 303103.76 9.91+3+19.72 1490 1490 
Halocidin subunit A 181929.04 9.04+1+12.04 5500 5500 
Halocidin subunit B151515.839.04+1+14.53 0
Pardaxins 1333393.846.970+15.030
Pardaxins 2333321.829.95+1+12.68 
Pardaxins 3333427.826.970+14.5700
Pardaxins 4333321.829.95+1+12.55 
Pardaxins 5333379.826.930+15.04 0
Polyphemusin I182457.1810.54+7+15.2487308480
Polyphemusin II182429.1710.33+7+16.2387308480
Tachyplesin II172267.0910.01+6+14.0287308480
Tachyplesin III162110.999.48+5+12.2187308480

Table 2: Properties of the different peptides’ amino acids sequences.

Drawing cyclic peptides structures based on disulfide bonds

Seven studied peptides (Arenicin 1 and 2, Polyphemusin I and II, Tachyplesin II and III, and Aurelin) had cyclic structures via disulfide bond between cysteine residues (Figure 6). The other thirteen sequences formed only linear structures due to the absence of cysteine residues (Pardaxins l-5 and Clavanin-A-E) or presence of only one cysteine (Dicynthaurin, and 

Halocidin subunit A and B). The most unique cyclic structure was for Aurelin as the peptide contains 6 cysteine residues (Figure 6). These cyclic structures could make them more unaffected by proteolysis performed by proteases of gastrointestinal tract due to steric factors (Pangestuti and Kim, 2017, Saint Jean et al., 2017, Ibrahim et al., 2018, Phyo et al., 2018).

Figure 6: Unique cyclic structures of seven from twenty studied peptides via disulphide bond between cysteines

Concluding the amino acids-% in the investigated peptides

To deepen our understanding to the 20 selected marine bioeffective peptides and their amino acids constituents, amino acid-% distribution was checked. 

Stacked chart of the amino acids-% of investigated peptides in Figure 7 displayed that methionine did not exist at all in all of the 20 peptides. 

Figure 7: Stacked chart of the amino acids-% of investigated peptides.

 

Figure 8: Amino acids-% in investigated peptides with standard deviation

Figure 9: Cluster analysis for amino acids-% in investigated peptides

Demonstrated amino acids-% in investigated peptides with standard deviation of their existence % among peptides, which mirrored the distinction within different peptides constituent from each amino acid. This brief statistical estimation revealed the discrepancy among the amino acids as well as within each peptide class.

The composition of amino acids is strictly associated with bioeffectiveness of these bioeffective peptides. For instance, Arenicin 1 was found to have fungicidal efficacy that is dependent on tryptophan in its N terminus and arginine in its β-turn (Park et al., 2011). 

Cluster analysis for amino acids-% in investigated peptides in Figure 9 indicated that the twenty amino acids-% classified peptides to six major groups, where Pardaxins 1-5 were clustered in one group. The same case was found with Clavanin-A, -B, -C, -D and -E.  Dicynthaurin and Aurelin each could be considered as separate groups (Figure 9). Polyphemusin I and II, Tachyplesin II and III along with Arenicin 1 and 2 are grouped in one cluster. While, Halocidin subunit A and B were clustered together as in Figure 9.

Helical Wheel (HW)

The HW analysis investigated the distribution of the hydrophobic and hydrophilic amino acids on helical folding form of peptides. The results were summarized in Table 3. Table 3 showed that all peptides had higher numbers of hydrophilic amino acids than hydrophobic ones except for Aurelin, Tachyplesin II and III, and Polyphemusin I and II. Hydrophobic amino acids in peptides have critical contribution to their bactericidal effectiveness as they enhance peptides ability to bind and disintegrate membranes of bacteria (Saint Jean et al., 2017). The overall differences between the numbers of the hydrophobic and hydrophilic amino acids ranged from two to four (Table 3). Meanwhile, the oddest difference was in case of Aurelin, which showed differences equal to 10 amino acids (Table 3)

NAME

HYDROPHOBIC AND HYDROPHILIC AMINO ACIDS DISTRIBUTIONNO. OF HYDROPHOBIC AMINO ACIDSNO. OF HYDROPHILIC AMINO ACIDS
PARDAXINS 1GFFALIPKIISSPLFKTLLSAVGSALSSSGEQE1315
PARDAXINS 2GFFALIPKIISSPIFKTLLSAVGSALSSSGGQE1215
PARDAXINS 3GFFAFIPKIISSPLFKTLLSAVGSALSSSGEQE1315
PARDAXINS 4GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE1215
PARDAXINS 5GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE1315
ARENICIN 1RWCVYAYVRVRGVLVRYRRCW69
ARENICIN 2RWCVYAYVRIRGVLVRYRRCW69
CLAVANIN-AVFQFLGKIIHHVGNFVHGFSHVF811
CLAVANIN-BVFQFLGRIIHHVGNFVHGFSHVF811
CLAVANIN-EFKLLGKIIHHVGNFVHGFSHVF811
CLAVANIN-CVFHLLGKIIHHVGNFVYGFSHVF711
CLAVANIN-DFKLLGRIIHHVGNFVYGFSHVF711
AURELINAACSDRAHGHICESFKSFCKDSGRNGVKLRANCKKTCGLC2010
DICYNTHAURINILQKAVLDCLKAAGSSLSKAAITAIYNKIT1215
HALOCIDIN SUBUNIT AWLNALLHHGLNCAKGVLA510
HALOCIDIN SUBUNIT BALLHHGLNCAKGVLA48
TACHYPLESIN IIRWCFRVCYRGICYRKCR64
POLYPHEMUSIN IRRWCFRVCYRGFCYRKCR74
TACHYPLESIN IIIWCFRVCYRGICYRKCR54
POLYPHEMUSIN IIRRWCFRVCYKGFCYRKCR74

Table 3:The hydrophobic amino acids (red) and hydrophilic ones (blue) distribution through the complete peptides sequences.

Table 4 demonstrated the hydrophobic amino acids (red) and hydrophilic ones (blue) distribution through reduced hypothetical peptides sequences. The numbers of hydrophobic amino acids was significantly reduced after sequence reductions. 

Name

Hydrophobic and hydrophilic amino acids distributionNo. of hydrophobic amino acidsNo. of hydrophilic amino acids
Pardaxins 1GFFLIPIISSPLFKTLLSAVGSALSS814
Pardaxins 2GFFLIPIISSPIFKTLLSAVGSALSS814
Pardaxins 3GFFFIPIISSPLFKTLLSAVGSALSS814
Pardaxins 4GFFLIPIISSPLFKTLLSAVGSALSS814
Pardaxins 5GFFLIPIISSPLFKTLLSAVGSALSS814
Arenicin 1RWCYAYRVRGVYRRC54
Arenicin 2RWCYAYRIRGVYRRC54
Clavanin-AVFFLGIIHHVGNVHVF48
Clavanin-BVFFLGIIHHVGNVHVF49
Clavanin-EFLLGIIHHVGNVHVF49
Clavanin-CVFLLGIIHHVGNVHVF410
Clavanin-DFLLGIIHHVGNVHVF49
AurelinAACDHICESFKSFCDSGNGVLRKKTCLC138
DicynthaurinILQKAVLDCLKAAGSSLSAIYNKIT1012
Halocidin subunit AWLNLLHHGLNAA47
Halocidin subunit BLLHHGLNAA35
Tachyplesin IIRWCRVCRGYRKC52
Polyphemusin IRRWCRVCRGYRKC62
Tachyplesin IIIWCRVCRGYRKC42
Polyphemusin IIRRWCRVCKGYRKC52

Table 4:The hydrophobic amino acids (red) and hydrophilic ones (blue) distribution through reduced hypothetical peptides sequences.

Specifying the amino acids that had disorder

The amino acids that had disorder in the twenty investigated complete sequences of marine bioeffective peptides were specified from PrDOS as demonstrated in Figure 10. The red color in the sequences signified amino acids with disorder. According to PrDOS, Halocidin subunit B (15 amino acids length) was totally disordered (Figure 10). None of the peptides was 

totally ordered, nevertheless Polyphemusin II (18 amino acids) had only one disordered amino acid (Figure 10). 

PrDOS could act on all investigated sequences whatever their lengths are (Ishida and Kinoshita, 2007). This algorithm anticipates disorder from sequences of amino acids. The probabilities below 0.5 in the curve showed ordered residues, while those above 0.5 showed disordered ones (Figure 10). 

Figure 10: Disorder probability for 20 peptides’ complete sequences obtained from PrDOS server.

The red colored residues in the sequences represent amino acids with intrinsic disorder.

Figure 11 revealed disorder in seven peptides complete sequences (that comprise 30 or more amino acids) obtained from PONDR. The red color in the sequences exemplifies amino acids with disorder. Dicynthaurin is a naturally ordered peptide (via PONDR score). Aurelin had the highest numbers of disordered residues (16 of 40), Pardaxins 1, 3, and 5 had 11 disordered residues, and Pardaxins 2 and 4 had 12 ones (Figure 11).  The scores below 0.5 showed ordered residues, while those above 0.5 showed disordered ones (Figure 11). 

Figure 11: Intrinsic disorder for seven peptides’ complete sequences (that comprise 30 or more amino acids) obtained from PONDR. The red color in the sequences represents amino acids with disorder.

As can be concluded from Figure 10 and Figure 11, there are differences in the records obtained from both algorithms. These differences originated from the variation in their anticipation method since PONDR depend on matching queries to crystallization data of natural proteins not the sequence itself (Li et al., 1999).

Figure 12 presented flDPnn propensity of disorder in investigated peptides sequences. Records of disorder are vital in designing of de novo or hybrid peptides as they are strictly linked to peptides bioeffectiveness (Dunker et al., 2000, Ward et al., 2004, Shimizu et al., 2007).

Figure 12: flDPnn propensity of disorder in investigated peptides sequences.

Conclusion

This study investigated twenty bioeffective peptides from marine derivation. It focused on comparative exploration for amino acids-% in the different peptides, alignment, phylogeny tree, chemical and physical parameters, hydrophobic/hydrophilic amino acids, cyclic structures based on disulfide bonds, and intrinsic disorder. The study included reducing the original sequences to map the internal similarity that might be hidden in the different peptides. The achieved results can be beneficial in planning de novo or hybrids of these peptides.

Author Contributions:

N.A.E.-B. and A.A.A.: Conceptualization, Methodology, Data curation and analysis, draft writing.  N.A.E.-B. revised and finalized the work. Both authors read and agreed to the manuscript.

Conflicts of Interest:

The authors declare no conflict of interest.

References

Dear Editorial Team, Clinical Medical Reviews and Reports. My experience with the journal was highly positive. The peer-review process was rigorous, constructive, and completed in a timely manner. The reviewers provided valuable comments that helped improve the quality and clarity of our manuscript. The editorial office was professional, responsive, and supportive throughout all stages of the publication process. Communication was clear and efficient, and any questions were addressed promptly. Overall, I found the journal to maintain high scientific standards and an excellent publication workflow. I would be pleased to consider submitting future work to this journal. Best wishes from, Elena Popa.

img

Dr Elena Popa

It was my pleasure to submit my testimonial concerning the Reviewer Board of our Scientific Journal “Brain and Neurological Disorders”. The Reviewers focused on some modifications and their contribution was helpful. The ladies of our Editorial Office were also supported my efforts. It was my honor to have such a co-operation and I am looking forward for more collaboration.

img

Dr Nikolaos Andreas Chrysanthakopoulos

Dear Grace Pierce, Editorial Coordinator of Journal of Clinical Research and Reports, Thank you for the speedy and efficient peer review process. I appreciate the fact that your peer reviewers do not take months to respond like with some other journals. I would also like to thank the editorial office for responding quickly to my questions. It is an excellent journal. I plan to submit more manuscripts in the future. Best wishes from, Robert W. McGee

img

Robert W McGee

Dear Grace Pierce, Editorial Coordinator of Journal of Clinical Research and Reports, Working with you and your team on our recent publication in JCRR has been a truly wonderful and enjoyable experience. The responses were prompt, and the reviewers were patient, constructive, and highly professional. One reviewer in particular gave me the feeling that a professor was carefully reading and commenting on my coursework, which was deeply touching. The entire process was straightforward and hassle‑free, with no tedious online forms to complete. I highly recommend this journal. Best wishes from, DR Aibing Rao, Head of R&D

img

Aibing Rao

I Appreciate the Opportunity to Share my Experience with the Journal of Clinical Research and Reports. The peer review process was timely and constructive, and the feedback provided helped improve the quality of our manuscript. The editorial office was professional, responsive, and supportive throughout the process, ensuring smooth communication and efficient handling of the submission. Overall, it was a positive experience collaborating with your team.

img

Kashani Mehdi

Dear Mercy Grace, Editorial Coordinator of Obstetrics Gynecology and Reproductive Sciences, We would like to express our gratitude for your help at all stages of publishing and editing the article. The editors of the magazine answer all the necessary questions and help at every stage. We will definitely continue to cooperate and publish other works in the Obstetrics Gynecology and Reproductive Sciences! Best wishes from, Alla Konstantinovna Politova,

img

Alla Konstantinovna Politova